PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G009000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 382aa    MW: 41488.3 Da    PI: 7.9062
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G009000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.95.4e-4292167277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          C v+gC++dls++++yhrrhkvCe+hsk+p+v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+ 
  Manes.12G009000.1.p  92 CLVDGCTSDLSKCRDYHRRHKVCEIHSKTPKVFIKGQEQRFCQQCSRFHSLGEFDEGKRSCRKRLDGHNRRRRKPP 167
                          **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-3486153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.20689166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3990171IPR004333Transcription factor, SBP-box
PfamPF031101.3E-3092165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGYNLKTTWR LAELENQNIP HIAQKLGTTC SSGLHQAPGH CSVDLKLGNS GDLEDKLMEK  60
FAGPGESLME SSSSGTSKRV RTPVNGTQVP LCLVDGCTSD LSKCRDYHRR HKVCEIHSKT  120
PKVFIKGQEQ RFCQQCSRFH SLGEFDEGKR SCRKRLDGHN RRRRKPPPDS LSVNSATLFS  180
NHQGTRYLQF GGFQMFSAGS ESSAWTEAAK PDNGPMLYAS QFSVSHSSGR NLFPGSLSQG  240
YRSAKQFPFL QCTSSTLPGE SVCQNIIDTD SILDSSQKMF SGGSNRVVDS NRALSLLSSP  300
SAETQEIGLS HMVQPDLKPP AQSLIPSLNF SFSGMENGSV DSVLVSDGSS NANLHGQAMF  360
QIGPDESSTS GSLQTLSFSW E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-3189165884squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148165KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085714.10.0PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLB9RMC20.0B9RMC2_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s13630.11e-174(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-51SBP family protein